Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNO1 Rabbit Polyclonal Antibody (Biotin)

PNO1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RRP20, KHRBP1

UniProt

B4DLZ8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QAEQLSAAGEGGDAGRMDTEEARPAKRPVFPPLCGDGLLSGKEETRKIPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001193997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Assay Kit
6023 1 Kit

DNA Assay Kit

Sign In for Pricing
View Details
PIN, FLOATING, TUBE, Stainless Steel, Solid, Delivers ~4nL Hanging Drop, 0.229mm Diameter, 30mm Exposed Length, 50.8mm Total Length
FP9T 1 Each

PIN, FLOATING, TUBE, Stainless Steel, Solid, Delivers ~4nL Hanging Drop, 0.229mm Diameter, 30mm Exposed Length, 50.8mm Total Length

Sign In for Pricing
View Details
MECR Rabbit Polyclonal Antibody (Biotin)
orb2095657 100 µL

MECR Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
COL6A2 (Collagen VI alpha 2 Polypeptide, PP3610) (FITC)
MBS6412056-01 0.1 mL

COL6A2 (Collagen VI alpha 2 Polypeptide, PP3610) (FITC)

Sign In for Pricing
View Details
COL6A2 (Collagen VI alpha 2 Polypeptide, PP3610) (FITC)
MBS6412056-02 5x 0.1 mL

COL6A2 (Collagen VI alpha 2 Polypeptide, PP3610) (FITC)

Sign In for Pricing
View Details
NUDT4, NT (NUDT4, DIPP2, KIAA0487, Diphosphoinositol polyphosphate phosphohydrolase 2, Diadenosine 5',5'''-P1, P6-hexaphosphate hydrolase 2, Nucleoside diphosphate-linked moiety X motif 4) (MaxLight 650) discontinued
039206-ML650 100 µL

NUDT4, NT (NUDT4, DIPP2, KIAA0487, Diphosphoinositol polyphosphate phosphohydrolase 2, Diadenosine 5',5'''-P1, P6-hexaphosphate hydrolase 2, Nucleoside diphosphate-linked moiety X motif 4) (MaxLight 650) discontinued

Sign In for Pricing
View Details