Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R1 Rabbit Polyclonal Antibody (HRP)

PPP4R1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MEG1, PP4R1, PP4 (Rmeg)

UniProt

Q8TF05

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

107kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001035847

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHPRH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G8]
TA501447BM 100 µL

SHPRH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G8]

Sign In for Pricing
View Details
TCEB2 Recombinant Rabbit Monoclonal Antibody [JE65-72]
HA721002 100 µL

TCEB2 Recombinant Rabbit Monoclonal Antibody [JE65-72]

Sign In for Pricing
View Details
PKC θ (Ab-695) Antibody
8B0804-AAT 50 µg

PKC θ (Ab-695) Antibody

Sign In for Pricing
View Details
2-Ethoxy-6,9-diaminoacridine Lactate
TRC-E261505-5G 5 g

2-Ethoxy-6,9-diaminoacridine Lactate

Sign In for Pricing
View Details
YAP1 Rabbit Polyclonal Antibody
AP06695PU-N 100 µg

YAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zkscan5 Mouse Gene Knockout Kit (CRISPR)
KN520097 1 Kit

Zkscan5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details