Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp1ca Rabbit Polyclonal Antibody (Biotin)

Ppp1ca Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pp, dis, Ppp1c, dism2

UniProt

P62137

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_114074

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cd300ld4 qPCR Primer Pair
QM78658S 200 Tests

Mouse Cd300ld4 qPCR Primer Pair

Sign In for Pricing
View Details
Ethyl Benzoyl Acetate 88% For Synthesis
115100100 100 mL

Ethyl Benzoyl Acetate 88% For Synthesis

Sign In for Pricing
View Details
SERPINF1 Antibody (N-term)
E45R32413G-1 100 µL

SERPINF1 Antibody (N-term)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 3 (ANGPTL3)
MBS2058067-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 3 (ANGPTL3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 3 (ANGPTL3)
MBS2058067-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 3 (ANGPTL3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 3 (ANGPTL3)
MBS2058067-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Angiopoietin Like Protein 3 (ANGPTL3)

Sign In for Pricing
View Details