Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp1ca Rabbit Polyclonal Antibody (FITC)

Ppp1ca Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Pp, dis, Ppp1c, dism2

UniProt

P62137

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_114074

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1463 (NM_001000023) Rat Tagged ORF Clone Lentiviral Particle
RR215475L4V 200 µL

Olr1463 (NM_001000023) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD11a (Integrin Alpha L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA1A, Ly15, Ly21, Lymphocyte Function Associated Antigen Type 1 alpha, p180) discontinued
C2262-27G 500 µg

CD11a (Integrin Alpha L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA1A, Ly15, Ly21, Lymphocyte Function Associated Antigen Type 1 alpha, p180) discontinued

Sign In for Pricing
View Details
HEC1 (NDC80) Human Over-expression Lysate
orb1346855 100 µg

HEC1 (NDC80) Human Over-expression Lysate

Sign In for Pricing
View Details
GLT11 Antibody (N-term)
MBS9208077-01 0.08 mL

GLT11 Antibody (N-term)

Sign In for Pricing
View Details
GLT11 Antibody (N-term)
MBS9208077-02 0.4 mL

GLT11 Antibody (N-term)

Sign In for Pricing
View Details
GLT11 Antibody (N-term)
MBS9208077-03 5x 0.4 mL

GLT11 Antibody (N-term)

Sign In for Pricing
View Details