Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp1ca Rabbit Polyclonal Antibody (HRP)

Ppp1ca Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pp, dis, Ppp1c, dism2

UniProt

P62137

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_114074

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FAM123A Antibody [FITC]
NBP3-05964F 0.1 mL

Rabbit Polyclonal FAM123A Antibody [FITC]

Sign In for Pricing
View Details
RVNP2 Protein Vector (Human) (pPB-N-His)
PV127559 500 ng

RVNP2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
DGCR6 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11722R-BF594 100 µL

DGCR6 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Rnase1 Recombinant Protein (Human)
RP026518 100 µg

Rnase1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Autophagy-related protein 21 (ATG21)
MBS1472047-01 0.05 mg (E-Coli)

Recombinant Kluyveromyces lactis Autophagy-related protein 21 (ATG21)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Autophagy-related protein 21 (ATG21)
MBS1472047-02 0.05 mg (Yeast)

Recombinant Kluyveromyces lactis Autophagy-related protein 21 (ATG21)

Sign In for Pricing
View Details