Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUBCNL Rabbit Polyclonal Antibody (HRP)

RUBCNL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PACER, C13orf18, KIAA0226L

UniProt

Q96CS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_612452

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB11 (Ankyrin Repeat and SOCS Box Protein 11, ASB-11, DKFZp779E2460, MGC119168, MGC119169)
123596 100 µg

ASB11 (Ankyrin Repeat and SOCS Box Protein 11, ASB-11, DKFZp779E2460, MGC119168, MGC119169)

Sign In for Pricing
View Details
BVES siRNA (Rat)
CRR6287-01 15 nmol

BVES siRNA (Rat)

Sign In for Pricing
View Details
BVES siRNA (Rat)
CRR6287-02 30 nmol

BVES siRNA (Rat)

Sign In for Pricing
View Details
Caudal Type Homeobox 2 (CDX2) Monoclonal Antibody
CAU32060-01 100 µL

Caudal Type Homeobox 2 (CDX2) Monoclonal Antibody

Sign In for Pricing
View Details
Caudal Type Homeobox 2 (CDX2) Monoclonal Antibody
CAU32060-02 200 µL

Caudal Type Homeobox 2 (CDX2) Monoclonal Antibody

Sign In for Pricing
View Details
Caudal Type Homeobox 2 (CDX2) Monoclonal Antibody
CAU32060-03 1 mL

Caudal Type Homeobox 2 (CDX2) Monoclonal Antibody

Sign In for Pricing
View Details