Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP68 Rabbit Polyclonal Antibody (FITC)

CEP68 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KIAA0582

UniProt

Q8TAP6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ANREPVAERSEPALSGLPPATMGSGDLLLSGESQVEKTKLSSSEEFPQTL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_079175

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vibecotamab (CD3 epsilon/ IL3RA) - Research Grade Biosimilar Antibody
orb1237267 0.1 mg

Vibecotamab (CD3 epsilon/ IL3RA) - Research Grade Biosimilar Antibody

Sign In for Pricing
View Details
Lentiviral mouse Scml4 shRNA (UAS) - Lentiviral mouse Scml4 shRNA (UAS, iRFP) (25)
GTR15215318 1 Vial

Lentiviral mouse Scml4 shRNA (UAS) - Lentiviral mouse Scml4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
DDX53 (CAGE, Probable ATP-dependent RNA Helicase DDX53, Cancer-associated Gene Protein, Cancer/Testis Antigen 26, CT26, DEAD Box Protein 53, DEAD Box Protein CAGE) (MaxLight 650)
125740-ML650 100 µL

DDX53 (CAGE, Probable ATP-dependent RNA Helicase DDX53, Cancer-associated Gene Protein, Cancer/Testis Antigen 26, CT26, DEAD Box Protein 53, DEAD Box Protein CAGE) (MaxLight 650)

Sign In for Pricing
View Details
Guinea pig Anti-Collapsin response mediator protein 5 antibody ELISA Kit
MBS752918-01 48 Well

Guinea pig Anti-Collapsin response mediator protein 5 antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Collapsin response mediator protein 5 antibody ELISA Kit
MBS752918-02 96 Well

Guinea pig Anti-Collapsin response mediator protein 5 antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Collapsin response mediator protein 5 antibody ELISA Kit
MBS752918-03 5x 96 Well

Guinea pig Anti-Collapsin response mediator protein 5 antibody ELISA Kit

Sign In for Pricing
View Details