Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP76 Rabbit Polyclonal Antibody (FITC)

CEP76 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C18orf9, HsT1705

UniProt

Q8TAP6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SVGILNIKLEMYPPLNQTLSQEVVNTQLALERQKTAEKERLFLVYAKQWW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079175

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neosartorya fumigata Formation of crista junctions protein 1 (fcj1)
orb2923365-01 20 µg

Recombinant Neosartorya fumigata Formation of crista junctions protein 1 (fcj1)

Sign In for Pricing
View Details
Recombinant Neosartorya fumigata Formation of crista junctions protein 1 (fcj1)
orb2923365-02 100 µg

Recombinant Neosartorya fumigata Formation of crista junctions protein 1 (fcj1)

Sign In for Pricing
View Details
Mouse Potassium channel subfamily K member 13, KCNK13 ELISA Kit
MBS1600950-01 48 Well

Mouse Potassium channel subfamily K member 13, KCNK13 ELISA Kit

Sign In for Pricing
View Details
Mouse Potassium channel subfamily K member 13, KCNK13 ELISA Kit
MBS1600950-02 96 Well

Mouse Potassium channel subfamily K member 13, KCNK13 ELISA Kit

Sign In for Pricing
View Details
Mouse Potassium channel subfamily K member 13, KCNK13 ELISA Kit
MBS1600950-03 5x 96 Well

Mouse Potassium channel subfamily K member 13, KCNK13 ELISA Kit

Sign In for Pricing
View Details
Mouse Potassium channel subfamily K member 13, KCNK13 ELISA Kit
MBS1600950-04 10x 96 Well

Mouse Potassium channel subfamily K member 13, KCNK13 ELISA Kit

Sign In for Pricing
View Details