Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ell3 Rabbit Polyclonal Antibody (FITC)

Ell3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A930015D22Rik

UniProt

Q80VR2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ell3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PEHKVLEDKIVQEYKKFRKRYPSYREEKHRCEYLHQKLSHIKGLILEFEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_666085

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IκBα (Inhibitory Subunit of NF Kappa B Alpha) ELISA Kit
RE2433H-01 48 Tests

Human IκBα (Inhibitory Subunit of NF Kappa B Alpha) ELISA Kit

Sign In for Pricing
View Details
Human IκBα (Inhibitory Subunit of NF Kappa B Alpha) ELISA Kit
RE2433H-02 96 Tests

Human IκBα (Inhibitory Subunit of NF Kappa B Alpha) ELISA Kit

Sign In for Pricing
View Details
LINC00158 Recombinant Protein (Human)
RP068247 100 µg

LINC00158 Recombinant Protein (Human)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Sulfate/thiosulfate import ATP-binding protein CysA (cysA)
MBS1446027-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis Sulfate/thiosulfate import ATP-binding protein CysA (cysA)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Sulfate/thiosulfate import ATP-binding protein CysA (cysA)
MBS1446027-02 0.02 mg (Yeast)

Recombinant Yersinia pestis Sulfate/thiosulfate import ATP-binding protein CysA (cysA)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Sulfate/thiosulfate import ATP-binding protein CysA (cysA)
MBS1446027-03 0.1 mg (E-Coli)

Recombinant Yersinia pestis Sulfate/thiosulfate import ATP-binding protein CysA (cysA)

Sign In for Pricing
View Details