Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP14 Rabbit Polyclonal Antibody (HRP)

FKBP14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EDSKMH, FKBP22, IPBP12, EDSKSCL2

UniProt

Q9NWM8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060416

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Mucin 17 ELISA Kit
MBS090560 Inquire

Goose Mucin 17 ELISA Kit

Sign In for Pricing
View Details
Fibroblast Growth Factor 2 (FGF2) Antibody (Biotin)
abx272002-01 200 µL

Fibroblast Growth Factor 2 (FGF2) Antibody (Biotin)

Sign In for Pricing
View Details
Fibroblast Growth Factor 2 (FGF2) Antibody (Biotin)
abx272002-02 1 mL

Fibroblast Growth Factor 2 (FGF2) Antibody (Biotin)

Sign In for Pricing
View Details
CD42b (CD42b Antigen, CD42b alpha, Antigen CD42b alpha, BSS, Glycocalicin, Glycoprotein Ib (Platelet) alpha Polypeptide, Glycoprotein Ib alpha, GP-Ib alpha, GPIb-alpha, GPIbA, GP1BA, MGC34595, Platelet Glycoprotein Ib alpha Chain, Platelet Glycoprotein Ib
MBS6250570-01 0.1 mL

CD42b (CD42b Antigen, CD42b alpha, Antigen CD42b alpha, BSS, Glycocalicin, Glycoprotein Ib (Platelet) alpha Polypeptide, Glycoprotein Ib alpha, GP-Ib alpha, GPIb-alpha, GPIbA, GP1BA, MGC34595, Platelet Glycoprotein Ib alpha Chain, Platelet Glycoprotein Ib

Sign In for Pricing
View Details
CD42b (CD42b Antigen, CD42b alpha, Antigen CD42b alpha, BSS, Glycocalicin, Glycoprotein Ib (Platelet) alpha Polypeptide, Glycoprotein Ib alpha, GP-Ib alpha, GPIb-alpha, GPIbA, GP1BA, MGC34595, Platelet Glycoprotein Ib alpha Chain, Platelet Glycoprotein Ib
MBS6250570-02 5x 0.1 mL

CD42b (CD42b Antigen, CD42b alpha, Antigen CD42b alpha, BSS, Glycocalicin, Glycoprotein Ib (Platelet) alpha Polypeptide, Glycoprotein Ib alpha, GP-Ib alpha, GPIb-alpha, GPIbA, GP1BA, MGC34595, Platelet Glycoprotein Ib alpha Chain, Platelet Glycoprotein Ib

Sign In for Pricing
View Details
IL10 Antibody
orb534699-01 20 µg

IL10 Antibody

Sign In for Pricing
View Details