Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMCH1 Rabbit Polyclonal Antibody (Biotin)

LIMCH1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LMO7B, LIMCH1A

UniProt

Q9UPQ0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EDVKPKTLPLDKSINHQIESPSERRKKSPREHFQAGPFSPCSPTPPGQSP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055803

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTAN1, CT (NTAN1, Protein N-terminal asparagine amidohydrolase, Protein NH2-terminal asparagine amidohydrolase, Protein NH2-terminal asparagine deamidase) (Biotin) discontinued
039179-Biotin 200 µL

NTAN1, CT (NTAN1, Protein N-terminal asparagine amidohydrolase, Protein NH2-terminal asparagine amidohydrolase, Protein NH2-terminal asparagine deamidase) (Biotin) discontinued

Sign In for Pricing
View Details
AR-A014418
A3184-10 10 mg

AR-A014418

Sign In for Pricing
View Details
GRAP2, ID (GRAP2, GADS, GRB2L, GRID, GRB2-related adapter protein 2, Adapter protein GRID, GRB-2-like protein, GRBLG, GRBX, Grf40 adapter protein, Growth factor receptor-binding protein, Hematopoietic cell-associated adapter protein GrpL, P38, Protein GAD
MBS6304255-01 0.1 mL

GRAP2, ID (GRAP2, GADS, GRB2L, GRID, GRB2-related adapter protein 2, Adapter protein GRID, GRB-2-like protein, GRBLG, GRBX, Grf40 adapter protein, Growth factor receptor-binding protein, Hematopoietic cell-associated adapter protein GrpL, P38, Protein GAD

Sign In for Pricing
View Details
GRAP2, ID (GRAP2, GADS, GRB2L, GRID, GRB2-related adapter protein 2, Adapter protein GRID, GRB-2-like protein, GRBLG, GRBX, Grf40 adapter protein, Growth factor receptor-binding protein, Hematopoietic cell-associated adapter protein GrpL, P38, Protein GAD
MBS6304255-02 5x 0.1 mL

GRAP2, ID (GRAP2, GADS, GRB2L, GRID, GRB2-related adapter protein 2, Adapter protein GRID, GRB-2-like protein, GRBLG, GRBX, Grf40 adapter protein, Growth factor receptor-binding protein, Hematopoietic cell-associated adapter protein GrpL, P38, Protein GAD

Sign In for Pricing
View Details
Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit
AE47920BO-01 48 Tests

Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit

Sign In for Pricing
View Details
Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit
AE47920BO-02 96 Tests

Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit

Sign In for Pricing
View Details