Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMCH1 Rabbit Polyclonal Antibody (HRP)

LIMCH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LMO7B, LIMCH1A

UniProt

Q9UPQ0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EDVKPKTLPLDKSINHQIESPSERRKKSPREHFQAGPFSPCSPTPPGQSP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055803

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tead1 (NM_001166585) Mouse Untagged Clone
MC217754 10 µg

Tead1 (NM_001166585) Mouse Untagged Clone

Sign In for Pricing
View Details
RBM26, NT (RBM26, C13orf10, RNA-binding protein 26, CTCL tumor antigen se70-2, RNA-binding motif protein 26) (MaxLight 490)
MBS6340746-01 0.1 mL

RBM26, NT (RBM26, C13orf10, RNA-binding protein 26, CTCL tumor antigen se70-2, RNA-binding motif protein 26) (MaxLight 490)

Sign In for Pricing
View Details
RBM26, NT (RBM26, C13orf10, RNA-binding protein 26, CTCL tumor antigen se70-2, RNA-binding motif protein 26) (MaxLight 490)
MBS6340746-02 5x 0.1 mL

RBM26, NT (RBM26, C13orf10, RNA-binding protein 26, CTCL tumor antigen se70-2, RNA-binding motif protein 26) (MaxLight 490)

Sign In for Pricing
View Details
Human TAS2R16 knockdown cell line
ABC-KD15081 1 Vial

Human TAS2R16 knockdown cell line

Sign In for Pricing
View Details
C7orf62 Antibody, Biotin conjugated
MBS1493180-01 0.05 mg

C7orf62 Antibody, Biotin conjugated

Sign In for Pricing
View Details
C7orf62 Antibody, Biotin conjugated
MBS1493180-02 0.1 mg

C7orf62 Antibody, Biotin conjugated

Sign In for Pricing
View Details