Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOHB Rabbit Polyclonal Antibody (FITC)

MAGOHB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGN2, mago, magoh

UniProt

Q96A72

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060518

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PON2 Matched Antibody Pair Set [ABP-S-02236]
ABP-S-02236 5 Plates

Mouse PON2 Matched Antibody Pair Set [ABP-S-02236]

Sign In for Pricing
View Details
Human Ubiquitin Conjugating Enzyme E2 D2 (UBE2D2) Protein
abx073231-01 5 µg

Human Ubiquitin Conjugating Enzyme E2 D2 (UBE2D2) Protein

Sign In for Pricing
View Details
Human Ubiquitin Conjugating Enzyme E2 D2 (UBE2D2) Protein
abx073231-02 20 µg

Human Ubiquitin Conjugating Enzyme E2 D2 (UBE2D2) Protein

Sign In for Pricing
View Details
Human Ubiquitin Conjugating Enzyme E2 D2 (UBE2D2) Protein
abx073231-03 1 mg

Human Ubiquitin Conjugating Enzyme E2 D2 (UBE2D2) Protein

Sign In for Pricing
View Details
Tet1 ORF Vector (Mouse) (pORF)
46518015 1.0 µg DNA

Tet1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RHBDF1 Antibody (FITC)
orb517846-01 50 µg

RHBDF1 Antibody (FITC)

Sign In for Pricing
View Details