Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mpped2 Rabbit Polyclonal Antibody (Biotin)

Mpped2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C11orf8, C11orf8h

UniProt

B1WBP0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Mpped2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_942073

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEKT1 Antibody
CSB-PA081579-01 50 μL

TEKT1 Antibody

Sign In for Pricing
View Details
TEKT1 Antibody
CSB-PA081579-02 100 µL

TEKT1 Antibody

Sign In for Pricing
View Details
PDCD2L (Programmed Cell Death Protein 2-like, MGC13096)
131033 100 µg

PDCD2L (Programmed Cell Death Protein 2-like, MGC13096)

Sign In for Pricing
View Details
Lentiviral human MRPL50 shRNA (UAS) - Lentiviral human MRPL50 shRNA (UAS, iRFP) (25)
GTR15348389 1 Vial

Lentiviral human MRPL50 shRNA (UAS) - Lentiviral human MRPL50 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CNNM2, CT (CNNM2, ACDP2, Metal transporter CNNM2, Ancient conserved domain-containing protein 2, Cyclin-M2)
034045 200 µL

CNNM2, CT (CNNM2, ACDP2, Metal transporter CNNM2, Ancient conserved domain-containing protein 2, Cyclin-M2)

Sign In for Pricing
View Details
TAGAP, ID (TAGAP, TAGAP1, T-cell activation Rho GTPase-activating protein, T-cell activation GTPase-activating protein) (MaxLight 750) discontinued
042588-ML750 100 µL

TAGAP, ID (TAGAP, TAGAP1, T-cell activation Rho GTPase-activating protein, T-cell activation GTPase-activating protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details