Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL43 Rabbit Polyclonal Antibody (FITC)

MRPL43 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L43mt, MRP-L43, bMRP36a

UniProt

Q8N983

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WHPFTNKPTTFRGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_789762

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit
MBS9356439-01 48 Well

Bovine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit

Sign In for Pricing
View Details
Bovine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit
MBS9356439-02 96 Well

Bovine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit

Sign In for Pricing
View Details
Bovine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit
MBS9356439-03 5x 96 Well

Bovine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit

Sign In for Pricing
View Details
Bovine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit
MBS9356439-04 10x 96 Well

Bovine Guanine Nucleotide-Binding Protein Subunit Beta-4 (GNB4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized hydrolase YNR064C (YNR064C)
MBS1032299-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Uncharacterized hydrolase YNR064C (YNR064C)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized hydrolase YNR064C (YNR064C)
MBS1032299-02 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Uncharacterized hydrolase YNR064C (YNR064C)

Sign In for Pricing
View Details