Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL43 Rabbit Polyclonal Antibody (HRP)

MRPL43 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L43mt, MRP-L43, bMRP36a

UniProt

Q8N983

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WHPFTNKPTTFRGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_789762

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey anti Goat IgG (heavy and light chains)
DoAG/IgG(H+L)/7S 10 mg

Donkey anti Goat IgG (heavy and light chains)

Sign In for Pricing
View Details
SLC27A5 Antibody
A47972-50UL 50 μL

SLC27A5 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal LRCH4 Antibody
NBP1-82821 0.1 mL

Rabbit Polyclonal LRCH4 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal PP2C gamma/PPM1G Antibody (112) [Janelia Fluor 646]
NBP2-89858JF646 0.1 mL

Rabbit Monoclonal PP2C gamma/PPM1G Antibody (112) [Janelia Fluor 646]

Sign In for Pricing
View Details
Human IL-2 High Sensitivity ELISA Kit
EK102HS-01 48 Tests

Human IL-2 High Sensitivity ELISA Kit

Sign In for Pricing
View Details
Human IL-2 High Sensitivity ELISA Kit
EK102HS-02 96 Tests

Human IL-2 High Sensitivity ELISA Kit

Sign In for Pricing
View Details