Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS9 Rabbit Polyclonal Antibody (HRP)

MRPS9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S9mt, RPMS9, MRP-S9

UniProt

P82933

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLESKKQLIEPVQYDEQGMAFSKSEGKRKTAKAEAIVYKHGSGRIKVNGI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_872578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin beta B Recombinant Rabbit mAb
orb2323505-01 25 µL

Inhibin beta B Recombinant Rabbit mAb

Sign In for Pricing
View Details
Inhibin beta B Recombinant Rabbit mAb
orb2323505-02 50 µL

Inhibin beta B Recombinant Rabbit mAb

Sign In for Pricing
View Details
Inhibin beta B Recombinant Rabbit mAb
orb2323505-03 100 µL

Inhibin beta B Recombinant Rabbit mAb

Sign In for Pricing
View Details
DHTKD1 Rabbit Polyclonal Antibody (Biotin)
orb3128891 100 µg

DHTKD1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MAF1 (MAF1 Homolog (S. cerevisiae), MGC20332, MGC31779, MGC39758) (MaxLight 490)
MBS6207232-01 0.1 mL

MAF1 (MAF1 Homolog (S. cerevisiae), MGC20332, MGC31779, MGC39758) (MaxLight 490)

Sign In for Pricing
View Details
MAF1 (MAF1 Homolog (S. cerevisiae), MGC20332, MGC31779, MGC39758) (MaxLight 490)
MBS6207232-02 5x 0.1 mL

MAF1 (MAF1 Homolog (S. cerevisiae), MGC20332, MGC31779, MGC39758) (MaxLight 490)

Sign In for Pricing
View Details