Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPRD1A Rabbit Polyclonal Antibody (Biotin)

RPRD1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P15RS, HsT3101

UniProt

Q96P16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060640

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNLY (LAG2, NKG5, TLA519, Granulysin, Lymphokine LAG-2, Protein NKG5, T-cell Activation Protein 519) (MaxLight 405)
MBS6190383-01 0.1 mL

GNLY (LAG2, NKG5, TLA519, Granulysin, Lymphokine LAG-2, Protein NKG5, T-cell Activation Protein 519) (MaxLight 405)

Sign In for Pricing
View Details
GNLY (LAG2, NKG5, TLA519, Granulysin, Lymphokine LAG-2, Protein NKG5, T-cell Activation Protein 519) (MaxLight 405)
MBS6190383-02 5x 0.1 mL

GNLY (LAG2, NKG5, TLA519, Granulysin, Lymphokine LAG-2, Protein NKG5, T-cell Activation Protein 519) (MaxLight 405)

Sign In for Pricing
View Details
PLVX-CMV-USP25 (human) -T61A-HA-PGK-Puro
BZ34937 1 Vial

PLVX-CMV-USP25 (human) -T61A-HA-PGK-Puro

Sign In for Pricing
View Details
Rat Complement C3b AssayMax™ ELISA Kit
ERC3331-1 96 Well

Rat Complement C3b AssayMax™ ELISA Kit

Sign In for Pricing
View Details
TIE2 Colorimetric Cell-Based ELISA Kit (OKAG01078)
OKAG01078 96 Well

TIE2 Colorimetric Cell-Based ELISA Kit (OKAG01078)

Sign In for Pricing
View Details
MAGE-B10 shRNA Plasmid (h)
sc-91279-SH 20 µg

MAGE-B10 shRNA Plasmid (h)

Sign In for Pricing
View Details