Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF1 Rabbit Polyclonal Antibody (Biotin)

SLAMF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SLAM, CD150, CDw150

UniProt

B2RAL4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_003028

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOP (B-1) PE
sc-374340 PE 200 µg/mL

FOP (B-1) PE

Sign In for Pricing
View Details
PRDX5 (Peroxiredoxin-5, Mitochondrial, Peroxiredoxin V, Prx-V, Peroxisomal Antioxidant Enzyme, PLP, Thioredoxin Reductase, Thioredoxin Peroxidase PMP20, Antioxidant Enzyme B166, AOEB166, TPx Type VI, Liver Tissue 2D-page Spot 71B, Alu Corepressor 1, SBBI10, ACR1) (MaxLight 405) discontinued
131758-ML405 100 µL

PRDX5 (Peroxiredoxin-5, Mitochondrial, Peroxiredoxin V, Prx-V, Peroxisomal Antioxidant Enzyme, PLP, Thioredoxin Reductase, Thioredoxin Peroxidase PMP20, Antioxidant Enzyme B166, AOEB166, TPx Type VI, Liver Tissue 2D-page Spot 71B, Alu Corepressor 1, SBBI10, ACR1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ITGB1 Antibody; HRP conjugated
MBS7004353-01 0.05 mg

ITGB1 Antibody; HRP conjugated

Sign In for Pricing
View Details
ITGB1 Antibody; HRP conjugated
MBS7004353-02 0.1 mg

ITGB1 Antibody; HRP conjugated

Sign In for Pricing
View Details
ITGB1 Antibody; HRP conjugated
MBS7004353-03 5x 0.1 mg

ITGB1 Antibody; HRP conjugated

Sign In for Pricing
View Details
Mouse Trbj2-5 activation kit by CRISPRa
GA219262 1 Kit

Mouse Trbj2-5 activation kit by CRISPRa

Sign In for Pricing
View Details