Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slamf1 Rabbit Polyclonal Antibody (HRP)

Slamf1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, IP, Slam, CD150, ESTM5, IPO-3, CDw150, ESTM51, AA177906, 4933415F16

UniProt

Q9QUM4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Slamf1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_038758

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ndufs1 Pre-designed siRNA Set B
SI209162B 1 Each

Rat Ndufs1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cox6a1 3'UTR GFP Stable Cell Line
TU252700 1.0 mL

Cox6a1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
IFluor® 670 Anti-human CD3 Antibody *OKT-3*
100340H1-AAT 500 Tests

IFluor® 670 Anti-human CD3 Antibody *OKT-3*

Sign In for Pricing
View Details
Rno-miR-547-3p miRNA Antagomir
orb1911447-01 10 nmol

Rno-miR-547-3p miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-547-3p miRNA Antagomir
orb1911447-02 20 nmol

Rno-miR-547-3p miRNA Antagomir

Sign In for Pricing
View Details
Anti-KLLN Polyclonal Antibody
TMAB-08128-01 50 μL

Anti-KLLN Polyclonal Antibody

Sign In for Pricing
View Details