Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slamf1 Rabbit Polyclonal Antibody (HRP)

Slamf1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, IP, Slam, CD150, ESTM5, IPO-3, CDw150, ESTM51, AA177906, 4933415F16

UniProt

Q9QUM4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Slamf1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_038758

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSPH siRNA (Human)
CRH3867-01 15 nmol

PSPH siRNA (Human)

Sign In for Pricing
View Details
PSPH siRNA (Human)
CRH3867-02 30 nmol

PSPH siRNA (Human)

Sign In for Pricing
View Details
Lentiviral mouse Krt73 shRNA (UAS) - Lentiviral mouse Krt73 shRNA (UAS, RFP) (25)
GTR15190619 1 Vial

Lentiviral mouse Krt73 shRNA (UAS) - Lentiviral mouse Krt73 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
IFNW1 Peptide
DF10109-BP 1 mg

IFNW1 Peptide

Sign In for Pricing
View Details
PRKCDBP-set siRNA/shRNA/RNAi Lentivector (Human)
37640091 4x 500 ng

PRKCDBP-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Human Proline/Serine Rich Coiled Coil protein 1 (PSRC1) ELISA Kit
DLR-PSRC1-Hu-01 48 Tests

Human Proline/Serine Rich Coiled Coil protein 1 (PSRC1) ELISA Kit

Sign In for Pricing
View Details