Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D20 Rabbit Polyclonal Antibody (HRP)

TBC1D20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WARBM4, C20orf140

UniProt

Q96BZ9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERTAASTFKDFELASAQQRPDMVLRQRFRGLLRPEDRTKDVLTKPRTNRF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIRAS1 (1-195, His-tag) Human Protein
AR09662PU-N 50 µg

DIRAS1 (1-195, His-tag) Human Protein

Sign In for Pricing
View Details
LRRC66 antibody - middle region (ARP44733_P050)
ARP44733_P050 100 µL

LRRC66 antibody - middle region (ARP44733_P050)

Sign In for Pricing
View Details
LECT2 Protein Vector (Rat) (pPM-C-HA)
PV277304 500 ng

LECT2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PRNP Polyclonal Antibody, Cy3 Conjugated
bs-11788R-Cy3-TR 20 µL

PRNP Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Canine Teichoic Acid Antibody ELISA Kit
MBS010819-01 48 Well

Canine Teichoic Acid Antibody ELISA Kit

Sign In for Pricing
View Details
Canine Teichoic Acid Antibody ELISA Kit
MBS010819-02 96 Well

Canine Teichoic Acid Antibody ELISA Kit

Sign In for Pricing
View Details