Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC39B Rabbit Polyclonal Antibody (Biotin)

TTC39B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C9orf52

UniProt

E9PC88

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VWNGFSIVSKRKDLSENLLVTVEKAEAALQSQNFNSFSVDDECLVKLLKG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001161814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED18 (Mediator of RNA Polymerase II Transcription Subunit 18, Mediator Complex Subunit 18, p28b) (MaxLight 405)
MBS6385197-01 0.1 mL

MED18 (Mediator of RNA Polymerase II Transcription Subunit 18, Mediator Complex Subunit 18, p28b) (MaxLight 405)

Sign In for Pricing
View Details
MED18 (Mediator of RNA Polymerase II Transcription Subunit 18, Mediator Complex Subunit 18, p28b) (MaxLight 405)
MBS6385197-02 5x 0.1 mL

MED18 (Mediator of RNA Polymerase II Transcription Subunit 18, Mediator Complex Subunit 18, p28b) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Rhodococcus sp. Dibenzothiophene desulfurization enzyme A (soxA)
MBS1229874-01 0.02 mg (E-Coli)

Recombinant Rhodococcus sp. Dibenzothiophene desulfurization enzyme A (soxA)

Sign In for Pricing
View Details
Recombinant Rhodococcus sp. Dibenzothiophene desulfurization enzyme A (soxA)
MBS1229874-02 0.02 mg (Yeast)

Recombinant Rhodococcus sp. Dibenzothiophene desulfurization enzyme A (soxA)

Sign In for Pricing
View Details
Recombinant Rhodococcus sp. Dibenzothiophene desulfurization enzyme A (soxA)
MBS1229874-03 0.1 mg (E-Coli)

Recombinant Rhodococcus sp. Dibenzothiophene desulfurization enzyme A (soxA)

Sign In for Pricing
View Details
Recombinant Rhodococcus sp. Dibenzothiophene desulfurization enzyme A (soxA)
MBS1229874-04 0.1 mg (Yeast)

Recombinant Rhodococcus sp. Dibenzothiophene desulfurization enzyme A (soxA)

Sign In for Pricing
View Details