Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mpp6 Rabbit Polyclonal Antibody (FITC)

Mpp6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P, P55, P55t, Pals2

UniProt

Q9JLB0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mpp6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BCL2L10 Antibody (8A11G12)
NBP2-61704-0.025mL 0.025 mL

Mouse Monoclonal BCL2L10 Antibody (8A11G12)

Sign In for Pricing
View Details
NUDT21 Mouse Monoclonal Antibody [Clone 1B1]
E45M17474V-2 50 µL

NUDT21 Mouse Monoclonal Antibody [Clone 1B1]

Sign In for Pricing
View Details
Mouse Monoclonal ACT11 Antibody (mAb2345a) [DyLight 755]
NBP2-53120IR 0.1 mL

Mouse Monoclonal ACT11 Antibody (mAb2345a) [DyLight 755]

Sign In for Pricing
View Details
Toll-like receptor 10 TLR10 Rabbit Polyclonal Antibody (Carrier-free)
orb3081120 100 µg

Toll-like receptor 10 TLR10 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Clara Cell Protein 16 (CC16) BioAssayTM ELISA Kit (Human)
024164-01 48 Tests

Clara Cell Protein 16 (CC16) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Clara Cell Protein 16 (CC16) BioAssayTM ELISA Kit (Human)
024164-02 96 Tests

Clara Cell Protein 16 (CC16) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details