Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3B2 Rabbit Polyclonal Antibody (FITC)

ALDH3B2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ALDH8

UniProt

P48448

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_000686

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Vasopressin-neurophysin 2-copeptin polyclonal Antibody, Biotin conjugated
MBS1490678-01 0.05 mg

Rabbit anti-human Vasopressin-neurophysin 2-copeptin polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Vasopressin-neurophysin 2-copeptin polyclonal Antibody, Biotin conjugated
MBS1490678-02 0.1 mg

Rabbit anti-human Vasopressin-neurophysin 2-copeptin polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Vasopressin-neurophysin 2-copeptin polyclonal Antibody, Biotin conjugated
MBS1490678-03 5x 0.1 mg

Rabbit anti-human Vasopressin-neurophysin 2-copeptin polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human MGMT (O-6-Methylguanine DNA Methyltransferase) ELISA Kit
RE2328H-01 48 Tests

Human MGMT (O-6-Methylguanine DNA Methyltransferase) ELISA Kit

Sign In for Pricing
View Details
Human MGMT (O-6-Methylguanine DNA Methyltransferase) ELISA Kit
RE2328H-02 96 Tests

Human MGMT (O-6-Methylguanine DNA Methyltransferase) ELISA Kit

Sign In for Pricing
View Details
Angptl4 Mouse Pre-designed siRNA Set A
HY-RS16575 1 Set

Angptl4 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details