Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3B2 Rabbit Polyclonal Antibody (HRP)

ALDH3B2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALDH8

UniProt

P48448

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000686

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pasteurella Multocida PM1790 Protein (aa 1-84)
VAng-Cr7187-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida PM1790 Protein (aa 1-84)

Sign In for Pricing
View Details
Rat Monoclonal Cathepsin 7 Antibody (RM0158-4A12) [PE]
NBP2-12424PE 0.1 mL

Rat Monoclonal Cathepsin 7 Antibody (RM0158-4A12) [PE]

Sign In for Pricing
View Details
Lentiviral human TBKBP1 shRNA (UAS) - Lentiviral human TBKBP1 shRNA (UAS, RFP) plasmid
GTR15323320 1 Vial

Lentiviral human TBKBP1 shRNA (UAS) - Lentiviral human TBKBP1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rat Galectin 7 ELISA Kit
MBS023028-01 48 Well

Rat Galectin 7 ELISA Kit

Sign In for Pricing
View Details
Rat Galectin 7 ELISA Kit
MBS023028-02 96 Well

Rat Galectin 7 ELISA Kit

Sign In for Pricing
View Details
Rat Galectin 7 ELISA Kit
MBS023028-03 5x 96 Well

Rat Galectin 7 ELISA Kit

Sign In for Pricing
View Details