Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL10 Rabbit Polyclonal Antibody (Biotin)

ARL10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARL10A

UniProt

Q8N8L6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARL10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAE

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_775935

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2, CT (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (APC)
MBS6498160-01 0.2 mL

ROR2, CT (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (APC)

Sign In for Pricing
View Details
ROR2, CT (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (APC)
MBS6498160-02 5x 0.2 mL

ROR2, CT (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (APC)

Sign In for Pricing
View Details
Recombinant Mouse Tumor necrosis factor receptor superfamily member 26 (Tnfrsf26), partial
MBS1241449-01 0.5 mg (E-Coli)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 26 (Tnfrsf26), partial

Sign In for Pricing
View Details
Recombinant Mouse Tumor necrosis factor receptor superfamily member 26 (Tnfrsf26), partial
MBS1241449-02 0.05 mg (Baculovirus)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 26 (Tnfrsf26), partial

Sign In for Pricing
View Details
Recombinant Mouse Tumor necrosis factor receptor superfamily member 26 (Tnfrsf26), partial
MBS1241449-03 0.5 mg (Yeast)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 26 (Tnfrsf26), partial

Sign In for Pricing
View Details
Recombinant Mouse Tumor necrosis factor receptor superfamily member 26 (Tnfrsf26), partial
MBS1241449-04 0.05 mg (Mammalian-Cell)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 26 (Tnfrsf26), partial

Sign In for Pricing
View Details