Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINDY3 Rabbit Polyclonal Antibody (HRP)

MINDY3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fam188a, RGD1309605

UniProt

D3Z916

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fam188a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CAVIAPVQAFLLKKLLFSSEKSSWRDCSEDEQKELLCHTLCDILESACDS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001099592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostate Specific Antigen, Total (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (AP) discontinued
P9054-30A-AP 100 µL

Prostate Specific Antigen, Total (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (AP) discontinued

Sign In for Pricing
View Details
Anti-HDAC6 (Recombinant Rabbit, Monoclonal, IgG)
A114109 100 µL

Anti-HDAC6 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
TNPO1 siRNA (Mouse)
orb1835902-01 15 nmol

TNPO1 siRNA (Mouse)

Sign In for Pricing
View Details
TNPO1 siRNA (Mouse)
orb1835902-02 30 nmol

TNPO1 siRNA (Mouse)

Sign In for Pricing
View Details
E2A (G-2) Alexa Fluor® 488
sc-133075 AF488 200 µg/mL

E2A (G-2) Alexa Fluor® 488

Sign In for Pricing
View Details
C14orf45 (BBOF1) (NM_025057) Human Over-expression Lysate
LH12234V 100 µg

C14orf45 (BBOF1) (NM_025057) Human Over-expression Lysate

Sign In for Pricing
View Details