Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC102B Rabbit Polyclonal Antibody (FITC)

CCDC102B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AN, ACY1L, HsT1731, C18orf14

UniProt

A1A4H1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TANWREKWSKVRAERNSAREEGRQLRIKLEMAMKELSTLKKKQSLPPQKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079057

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Hydroxy-2-methylbutanoic Acid
014011 100 mg

3-Hydroxy-2-methylbutanoic Acid

Sign In for Pricing
View Details
TTK (TTK Protein Kinase, ESK, FLJ38280, MPS1, MPS1L1, PYT) (MaxLight 405)
MBS6198510-01 0.1 mL

TTK (TTK Protein Kinase, ESK, FLJ38280, MPS1, MPS1L1, PYT) (MaxLight 405)

Sign In for Pricing
View Details
TTK (TTK Protein Kinase, ESK, FLJ38280, MPS1, MPS1L1, PYT) (MaxLight 405)
MBS6198510-02 5x 0.1 mL

TTK (TTK Protein Kinase, ESK, FLJ38280, MPS1, MPS1L1, PYT) (MaxLight 405)

Sign In for Pricing
View Details
TDP2 Protein (N-His, Human)
P508947 100 µg

TDP2 Protein (N-His, Human)

Sign In for Pricing
View Details
TATDN3 Antibody - C-terminal region
MBS3218955-01 0.1 mL

TATDN3 Antibody - C-terminal region

Sign In for Pricing
View Details
TATDN3 Antibody - C-terminal region
MBS3218955-02 5x 0.1 mL

TATDN3 Antibody - C-terminal region

Sign In for Pricing
View Details