Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc21 Rabbit Polyclonal Antibody (FITC)

Dnajc21 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

4930461P20Rik, 9930116P15Rik

UniProt

E9Q8D0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIRDRARKEKN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_084322

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog/Canine Protein Kinase Inhibitor Beta PKIb ELISA Kit
BG-CAN11833 1 Each

Dog/Canine Protein Kinase Inhibitor Beta PKIb ELISA Kit

Sign In for Pricing
View Details
ACAP3, NT (ACAP3, CENTB5, KIAA1716, Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3, Centaurin-beta-5) (AP)
MBS6270793-01 0.2 mL

ACAP3, NT (ACAP3, CENTB5, KIAA1716, Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3, Centaurin-beta-5) (AP)

Sign In for Pricing
View Details
ACAP3, NT (ACAP3, CENTB5, KIAA1716, Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3, Centaurin-beta-5) (AP)
MBS6270793-02 5x 0.2 mL

ACAP3, NT (ACAP3, CENTB5, KIAA1716, Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3, Centaurin-beta-5) (AP)

Sign In for Pricing
View Details
Salmonella Antiserum/Surowica Salmonella anty H:g - 3ml
SZ110 3 mL

Salmonella Antiserum/Surowica Salmonella anty H:g - 3ml

Sign In for Pricing
View Details
RRP8 Antibody
MBS8582983-01 0.1 mL

RRP8 Antibody

Sign In for Pricing
View Details
RRP8 Antibody
MBS8582983-02 0.1 mL (AF635)

RRP8 Antibody

Sign In for Pricing
View Details