Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc21 Rabbit Polyclonal Antibody (HRP)

Dnajc21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

4930461P20Rik, 9930116P15Rik

UniProt

E9Q8D0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIRDRARKEKN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_084322

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TP53TG5 Pre-designed siRNA Set A
SI017194A 1 Each

Human TP53TG5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
REMBRANDT® Universal DISH DIG-HRP detection assay
A001K.9901 100 Assays

REMBRANDT® Universal DISH DIG-HRP detection assay

Sign In for Pricing
View Details
TRM8 Antibody
orb852116 2 mg

TRM8 Antibody

Sign In for Pricing
View Details
FGF-18 HDR Plasmid (h)
sc-402175-HDR 20 µg

FGF-18 HDR Plasmid (h)

Sign In for Pricing
View Details
SIRT3 (Sirtuin Type 3, SIR2L3) (FITC)
MBS6437642-01 0.1 mL

SIRT3 (Sirtuin Type 3, SIR2L3) (FITC)

Sign In for Pricing
View Details
SIRT3 (Sirtuin Type 3, SIR2L3) (FITC)
MBS6437642-02 5x 0.1 mL

SIRT3 (Sirtuin Type 3, SIR2L3) (FITC)

Sign In for Pricing
View Details