Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTPBP5 Rabbit Polyclonal Antibody (HRP)

GTPBP5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ObgH1, GTPBP5, dJ1005F21.2

UniProt

Q9H4K7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of GTPBP5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056481

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPTIN7 Human Gene Knockout Kit (CRISPR)
KN205163BN 1 Kit

SEPTIN7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CGREF1 (NM_006569) Human Recombinant Protein
TP306520L 1 mg

CGREF1 (NM_006569) Human Recombinant Protein

Sign In for Pricing
View Details
Mix-n-StainTM CF®800 Antibody Labeling Kit, 1x (20-50ug) labeling
#92429 1 Kit

Mix-n-StainTM CF®800 Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
DHPS Rabbit Polyclonal Antibody
AP21160PU-N 100 µg

DHPS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse IL-1a (ALF-161) In Vivo Antibody - Low Endotoxin
ICH1099-50mg 50 mg

Anti-Mouse IL-1a (ALF-161) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
NKG2A (KLRC1) (NM_213658) Human Over-expression Lysate
LY403736 100 µg

NKG2A (KLRC1) (NM_213658) Human Over-expression Lysate

Sign In for Pricing
View Details