Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-E Rabbit Polyclonal Antibody (HRP)

HLA-E Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

QA1, HLA-6.2

UniProt

P13747

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Goat, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_005507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Collagen Type I Alpha 1 ELISA Kit
IHUCOL1A1KT 1 Each

Human Collagen Type I Alpha 1 ELISA Kit

Sign In for Pricing
View Details
Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS, SGB, SGBS, SGBS1) (MaxLight 550) discontinued
G8235-50C-ML550 100 µL

Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS, SGB, SGBS, SGBS1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rat Betacellulin/BTC ELISA Kit
EK5582 96 Tests

Rat Betacellulin/BTC ELISA Kit

Sign In for Pricing
View Details
ZFP408 Adenovirus (Mouse)
50960054 1.0 mL

ZFP408 Adenovirus (Mouse)

Sign In for Pricing
View Details
TCEB3 (Transcription Elongation Factor B Polypeptide 3, Elongin 110kD Subunit, Elongin-A, RNA Polymerase II Transcription Factor SIII Subunit A1, SIII p110, FLJ38760, FLJ42849) (MaxLight 750) discontinued
134285-ML750 100 µL

TCEB3 (Transcription Elongation Factor B Polypeptide 3, Elongin 110kD Subunit, Elongin-A, RNA Polymerase II Transcription Factor SIII Subunit A1, SIII p110, FLJ38760, FLJ42849) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Ebola Virus Viral Protein 40 (VP 40) Antibody
orb421073 1 mg

Ebola Virus Viral Protein 40 (VP 40) Antibody

Sign In for Pricing
View Details