Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-E Rabbit Polyclonal Antibody (HRP)

HLA-E Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

QA1, HLA-6.2

UniProt

P13747

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Goat, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_005507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Transcriptional regulator Kaiso
BP2089-500ug 500 µg

Recombinant Human Transcriptional regulator Kaiso

Sign In for Pricing
View Details
FCHO1 Rabbit Polyclonal Antibody (Cy3)
orb986616 100 µL

FCHO1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Lcn4 Mouse Gene Knockout Kit (CRISPR)
KN509185 1 Kit

Lcn4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLCN2 (NM_004366) Human Tagged ORF Clone
RC222621 10 µg

CLCN2 (NM_004366) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Csf3r shRNA (UAS) - Lentiviral mouse Csf3r shRNA (UAS, iRFP) plasmid
GTR15195244 1 Vial

Lentiviral mouse Csf3r shRNA (UAS) - Lentiviral mouse Csf3r shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Growth Hormone Releasing Factor GHRF (1-44) Amide Bovine Peptide
PE-55420-01 1 mg

Growth Hormone Releasing Factor GHRF (1-44) Amide Bovine Peptide

Sign In for Pricing
View Details