Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL1 Rabbit Polyclonal Antibody (Biotin)

MRPL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L1MT, BM022, MRP-L1

UniProt

Q9BYD6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KKTKKGAKEKTPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064621

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCILOGEX SCI-RL-E Analog Rotisserie Tube Rotator, with 36 x 1.5ml & 12ea 15/50ml centrifuge tube clamps, 100-220V, 50/60Hz, UK Plug
824220319999-01 1 Each

SCILOGEX SCI-RL-E Analog Rotisserie Tube Rotator, with 36 x 1.5ml & 12ea 15/50ml centrifuge tube clamps, 100-220V, 50/60Hz, UK Plug

Sign In for Pricing
View Details
Eclanamine Free Base
orb1740586-01 25 mg

Eclanamine Free Base

Sign In for Pricing
View Details
Eclanamine Free Base
orb1740586-02 50 mg

Eclanamine Free Base

Sign In for Pricing
View Details
Eclanamine Free Base
orb1740586-03 100 mg

Eclanamine Free Base

Sign In for Pricing
View Details
Sheep Olfactory receptor 4D2 (OR4D2) ELISA Kit
MBS7249099-01 48 Well

Sheep Olfactory receptor 4D2 (OR4D2) ELISA Kit

Sign In for Pricing
View Details
Sheep Olfactory receptor 4D2 (OR4D2) ELISA Kit
MBS7249099-02 96 Well

Sheep Olfactory receptor 4D2 (OR4D2) ELISA Kit

Sign In for Pricing
View Details