Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl22 Rabbit Polyclonal Antibody (HRP)

Mrpl22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rpm, MRP-, HSPC1, L22mt, Rpml25, HSPC158, MRP-L22, MRP-L25, E030011D16Rik

UniProt

Q8BU88

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mrpl22

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQIIKEVLLEAQDMAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_778166

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO40, Control Peptide (F-box Only Protein 40, Muscle Disease-related Protein, FBX40, KIAA1195, MGC129902, MGC129903)
147297 100 µg

FBXO40, Control Peptide (F-box Only Protein 40, Muscle Disease-related Protein, FBX40, KIAA1195, MGC129902, MGC129903)

Sign In for Pricing
View Details
Anti-Human Nesfatin 1/NUCB2 Antibody (SAA1759)
RHK86101 100 μg

Anti-Human Nesfatin 1/NUCB2 Antibody (SAA1759)

Sign In for Pricing
View Details
Ethyl 3-[ (Tetrahydropyranyl) oxy]butanoate
449030-01 100 mg

Ethyl 3-[ (Tetrahydropyranyl) oxy]butanoate

Sign In for Pricing
View Details
Ethyl 3-[ (Tetrahydropyranyl) oxy]butanoate
449030-02 250 mg

Ethyl 3-[ (Tetrahydropyranyl) oxy]butanoate

Sign In for Pricing
View Details
VB1 (Vitamin B1) BioAssayTM ELISA Kit discontinued
370296 96 Tests

VB1 (Vitamin B1) BioAssayTM ELISA Kit discontinued

Sign In for Pricing
View Details
ORM2 Blocking Peptide
MBS9627392-01 1 mg

ORM2 Blocking Peptide

Sign In for Pricing
View Details