Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl22 Rabbit Polyclonal Antibody (HRP)

Mrpl22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rpm, MRP-, HSPC1, L22mt, Rpml25, HSPC158, MRP-L22, MRP-L25, E030011D16Rik

UniProt

Q8BU88

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Mrpl22

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLHIAEST

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_778166

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solute Carrier Family 8 Member A2 (SLC8A2) Antibody
abx242479-01 50 µL

Solute Carrier Family 8 Member A2 (SLC8A2) Antibody

Sign In for Pricing
View Details
Solute Carrier Family 8 Member A2 (SLC8A2) Antibody
abx242479-02 100 µL

Solute Carrier Family 8 Member A2 (SLC8A2) Antibody

Sign In for Pricing
View Details
Myef2 (NM_001162418) Mouse Tagged ORF Clone
MR216060 10 µg

Myef2 (NM_001162418) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
EGFR (phospho-Tyr1197) Goat Polyclonal Antibody
ABM0427 100 µL

EGFR (phospho-Tyr1197) Goat Polyclonal Antibody

Sign In for Pricing
View Details
SIL1 antibody
70R-7154 50 ug

SIL1 antibody

Sign In for Pricing
View Details
Bronopol 99% Extrapure
52200100 100 mg

Bronopol 99% Extrapure

Sign In for Pricing
View Details