Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS6KA4 Rabbit Polyclonal Antibody (Biotin)

RPS6KA4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MSK2, RSK-B, S6K-alpha-4

UniProt

O75676

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001006945

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-10 L single-use bottle cap (NG)
BIOBGCBP803003 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

5-10 L single-use bottle cap (NG)

Sign In for Pricing
View Details
CLEC7A Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1585707 100 µL

CLEC7A Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Rabbit Polyclonal EPCR Antibody
NBP2-21578 0.1 mL

Rabbit Polyclonal EPCR Antibody

Sign In for Pricing
View Details
CLEC16A Polyclonal Antibody, Biotin Conjugated
bs-18539R-Biotin-TR 20 µL

CLEC16A Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Recombinant Synechococcus sp. ATP synthase gamma chain (atpG)
MBS1487731-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. ATP synthase gamma chain (atpG)
MBS1487731-02 0.02 mg (Yeast)

Recombinant Synechococcus sp. ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details