Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPRT Rabbit Polyclonal Antibody (HRP)

NAPRT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NAPRT1, PP3856

UniProt

Q6XQN6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQ

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660202

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bacti Caps 13mm dia Red
CAP1000 100 / PCK

Bacti Caps 13mm dia Red

Sign In for Pricing
View Details
TRNAG15 Protein Vector (Human) (pPM-C-His)
PV138833 500 ng

TRNAG15 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Human β-tryptase/TPSAB1 Recombinant Antibody (E104.v1)
HS931013-01 50 µg

Anti-Human β-tryptase/TPSAB1 Recombinant Antibody (E104.v1)

Sign In for Pricing
View Details
Anti-Human β-tryptase/TPSAB1 Recombinant Antibody (E104.v1)
HS931013-02 100 µg

Anti-Human β-tryptase/TPSAB1 Recombinant Antibody (E104.v1)

Sign In for Pricing
View Details
Anti-Human β-tryptase/TPSAB1 Recombinant Antibody (E104.v1)
HS931013-03 1 mg

Anti-Human β-tryptase/TPSAB1 Recombinant Antibody (E104.v1)

Sign In for Pricing
View Details
SENP2 Antibody
orb672997-01 50 µg

SENP2 Antibody

Sign In for Pricing
View Details