Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPRT Rabbit Polyclonal Antibody (FITC)

NAPRT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Na, Naprt1, 9130210N20Rik

UniProt

Q8CC86

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLIAGPDKKLLEMGLRRAQGPDGGFTASIYSYLGGFDSSSNTLAGQLRGV

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766195

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Dimethylamino-4-hydroxy-5-nitroso-6-aminopyrimidine
D3692-27 250 mg

2-Dimethylamino-4-hydroxy-5-nitroso-6-aminopyrimidine

Sign In for Pricing
View Details
Mouse Anti-Rabbit IgM Secondary Antibody-PE-Cy7
TMAB-02047PC7-01 100 µL

Mouse Anti-Rabbit IgM Secondary Antibody-PE-Cy7

Sign In for Pricing
View Details
Mouse Anti-Rabbit IgM Secondary Antibody-PE-Cy7
TMAB-02047PC7-02 1 mL

Mouse Anti-Rabbit IgM Secondary Antibody-PE-Cy7

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Glycerol-3-phosphate acyltransferase (plsY)
orb2912002-01 20 µg

Recombinant Chlorobium tepidum Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Glycerol-3-phosphate acyltransferase (plsY)
orb2912002-02 100 µg

Recombinant Chlorobium tepidum Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Collagen Type IV (Arresten, ASLN, ATS, CA54, Canstatin, COL4A1, COL4A2, Collagen Alpha 1 (IV) Chain, Collagen Alpha 2 (IV) Chain, Collagen IV Alpha 1 Polypeptide, Collagen IV Alpha 2 Polypeptide, Collagen of Basement Membrane Alpha 1 Chain, Collagen of Basement Membrane Alpha 2 Chain, Collagen Type IV Alpha 1, Collagen Type IV Alpha 2, DKFZp686I14213, FLJ22259, Goodpasture antigen) (AP) discontinued
C7510-50J-AP 100 µL

Collagen Type IV (Arresten, ASLN, ATS, CA54, Canstatin, COL4A1, COL4A2, Collagen Alpha 1 (IV) Chain, Collagen Alpha 2 (IV) Chain, Collagen IV Alpha 1 Polypeptide, Collagen IV Alpha 2 Polypeptide, Collagen of Basement Membrane Alpha 1 Chain, Collagen of Basement Membrane Alpha 2 Chain, Collagen Type IV Alpha 1, Collagen Type IV Alpha 2, DKFZp686I14213, FLJ22259, Goodpasture antigen) (AP) discontinued

Sign In for Pricing
View Details