Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP58 Rabbit Polyclonal Antibody (Biotin)

NUP58 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Nup45, Nupl1, p58/p45

UniProt

P70581

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Nupl1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGIDFSTSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_620791

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC93B Polyclonal Antibody
MBS9238595-01 0.1 mL

UNC93B Polyclonal Antibody

Sign In for Pricing
View Details
UNC93B Polyclonal Antibody
MBS9238595-02 5x 0.1 mL

UNC93B Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Delta Like 1 Homolog (dLK1) ELISA Kit
MBS458875-01 48 Tests

Mouse Delta Like 1 Homolog (dLK1) ELISA Kit

Sign In for Pricing
View Details
Mouse Delta Like 1 Homolog (dLK1) ELISA Kit
MBS458875-02 96 Tests

Mouse Delta Like 1 Homolog (dLK1) ELISA Kit

Sign In for Pricing
View Details
Mouse Delta Like 1 Homolog (dLK1) ELISA Kit
MBS458875-03 5x 96 Tests

Mouse Delta Like 1 Homolog (dLK1) ELISA Kit

Sign In for Pricing
View Details
Mouse Delta Like 1 Homolog (dLK1) ELISA Kit
MBS458875-04 10x 96 Tests

Mouse Delta Like 1 Homolog (dLK1) ELISA Kit

Sign In for Pricing
View Details