Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP58 Rabbit Polyclonal Antibody (HRP)

NUP58 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Nup45, Nupl1, p58/p45

UniProt

P70581

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Nupl1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGIDFSTSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_620791

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OX40/TNFRSF4 Recombinant Rabbit monoclonal Antibody
HA723189B 100 µL

Human OX40/TNFRSF4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ACAA2 Rabbit Monoclonal Antibody [Clone ID: 23GB2955]
TA424472S 20 µL

ACAA2 Rabbit Monoclonal Antibody [Clone ID: 23GB2955]

Sign In for Pricing
View Details
S100A1 Human Gene Knockout Kit (CRISPR)
KN200278 1 Kit

S100A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MyVolt™ Mini power supply, 230V
E2100-E 1 Each

MyVolt™ Mini power supply, 230V

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF405S conjugate, 0.1mg/mL
BNC041826-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MC-2 Recombinant Rabbit Monoclonal Antibody [JE61-09]
HA720055 100 µL

MC-2 Recombinant Rabbit Monoclonal Antibody [JE61-09]

Sign In for Pricing
View Details