Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R3C Rabbit Polyclonal Antibody (Biotin)

PPP1R3C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PTG, PPP1R5

UniProt

Q9UQK1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_005389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM5 Antibody : FITC (OAPB00224-FITC)
OAPB00224-100UG-FITC 0.1 mg

TRIM5 Antibody : FITC (OAPB00224-FITC)

Sign In for Pricing
View Details
Mouse ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit
MBS2532065-01 96 Tests

Mouse ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit

Sign In for Pricing
View Details
Mouse ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit
MBS2532065-02 5x 96 Tests

Mouse ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit

Sign In for Pricing
View Details
ZNF844 Polyclonal Antibody, Biotin Conjugated
A64047-100 100 µL

ZNF844 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
USP21, NT (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (Azide free) (HRP)
MBS6505237-01 0.2 mL

USP21, NT (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (Azide free) (HRP)

Sign In for Pricing
View Details
USP21, NT (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (Azide free) (HRP)
MBS6505237-02 5x 0.2 mL

USP21, NT (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (Azide free) (HRP)

Sign In for Pricing
View Details