Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R3C Rabbit Polyclonal Antibody (HRP)

PPP1R3C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PTG, PPP1R5

UniProt

Q9UQK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_005389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HcaD Antibody
orb817313 2 mg

HcaD Antibody

Sign In for Pricing
View Details
IL32 Antibody
orb671080-01 50 µg

IL32 Antibody

Sign In for Pricing
View Details
IL32 Antibody
orb671080-02 100 µg

IL32 Antibody

Sign In for Pricing
View Details
TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (MaxLight 405)
MBS6193034-01 0.1 mL

TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (MaxLight 405)

Sign In for Pricing
View Details
TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (MaxLight 405)
MBS6193034-02 5x 0.1 mL

TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (MaxLight 405)

Sign In for Pricing
View Details
ISG20 (NM_001303236) Human Tagged ORF Clone
RG236242 10 µg

ISG20 (NM_001303236) Human Tagged ORF Clone

Sign In for Pricing
View Details