Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC13 Rabbit Polyclonal Antibody (Biotin)

SEC13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SEC13R, npp-20, SEC13L1, D3S1231E

UniProt

P55735

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_899195

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LGALS3BP Antibody Pair Set
E-KAB-0265 50 µL & 100 µg

Human LGALS3BP Antibody Pair Set

Sign In for Pricing
View Details
3'-(2,2,2-Trifluoroacetate) 2'-Deoxy-2',2'-difluoro-N-(2,2,2-trifluoroacetyl)-5’-cytidylic Acid
TRC-D103590-10MG 10 mg

3'-(2,2,2-Trifluoroacetate) 2'-Deoxy-2',2'-difluoro-N-(2,2,2-trifluoroacetyl)-5’-cytidylic Acid

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3226), CF647 conjugate, 0.1mg/mL
BNC473226-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3226), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phenolphthalein b-D-Glucuronide (~90%)
TRC-P318015-500MG 500 mg

Phenolphthalein b-D-Glucuronide (~90%)

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF647 conjugate, 0.1mg/mL
BNC472427-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Helix pomatia Lectin (Edible Snail) -HPA-,  10nm
GP-3601-10 1 mL

Colloidal Gold Conjugated Helix pomatia Lectin (Edible Snail) -HPA-, 10nm

Sign In for Pricing
View Details