Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Rabbit Polyclonal Antibody (Biotin)

SNTB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SNT3, SNTL, SNT2B2, EST25263, D16S2531E

UniProt

Q13425

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSM

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibroblast Growth Factor 10 (FGF10) ELISA Kit
RDR-FGF10-Hu-01 96 Tests

Human Fibroblast Growth Factor 10 (FGF10) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 10 (FGF10) ELISA Kit
RDR-FGF10-Hu-02 48 Tests

Human Fibroblast Growth Factor 10 (FGF10) ELISA Kit

Sign In for Pricing
View Details
MAGEA3 Mouse Monoclonal
MBS7601170-01 0.1 mg

MAGEA3 Mouse Monoclonal

Sign In for Pricing
View Details
MAGEA3 Mouse Monoclonal
MBS7601170-02 5x 0.1 mg

MAGEA3 Mouse Monoclonal

Sign In for Pricing
View Details
Human C11orf58 Pre-designed siRNA Set A
SI001770A 1 Each

Human C11orf58 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GRB14 (Growth Factor Receptor-Bound Protein 14, Growth Factor Receptor-Bound Protein 7)
482222 100 µL

GRB14 (Growth Factor Receptor-Bound Protein 14, Growth Factor Receptor-Bound Protein 7)

Sign In for Pricing
View Details