Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Rabbit Polyclonal Antibody (Biotin)

SNTB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SNT3, SNTL, SNT2B2, EST25263, D16S2531E

UniProt

Q13425

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNTB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQ

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYPD6B Rabbit Polyclonal Antibody
orb155095 100 µg

LYPD6B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
8-Carboxy-1,3,5,7-tetramethyl BODIPY, Meso-COOH
T205830-01 1 mg

8-Carboxy-1,3,5,7-tetramethyl BODIPY, Meso-COOH

Sign In for Pricing
View Details
8-Carboxy-1,3,5,7-tetramethyl BODIPY, Meso-COOH
T205830-02 5 mg

8-Carboxy-1,3,5,7-tetramethyl BODIPY, Meso-COOH

Sign In for Pricing
View Details
Rat MMP2 (Matrix Metalloproteinase 2) Microsample ELISA Kit
orb2998783-01 48 Tests

Rat MMP2 (Matrix Metalloproteinase 2) Microsample ELISA Kit

Sign In for Pricing
View Details
Rat MMP2 (Matrix Metalloproteinase 2) Microsample ELISA Kit
orb2998783-02 96 Tests

Rat MMP2 (Matrix Metalloproteinase 2) Microsample ELISA Kit

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)
MBS2041844-01 0.1 mL

PE-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details