Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx12 Rabbit Polyclonal Antibody (HRP)

Snx12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1565585

UniProt

D4A719

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Snx12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001102287

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBBP6 Antibody - N-terminal region : Biotin (ARP43081_P050-Biotin)
ARP43081_P050-Biotin 100 µL

RBBP6 Antibody - N-terminal region : Biotin (ARP43081_P050-Biotin)

Sign In for Pricing
View Details
SF3A2 (Splicing Factor 3A Subunit 2, PRP11, PRPF11, SF3a66, Spliceosome-associated Protein 62, SAP 62, SAP62) (MaxLight 490)
MBS6203240-01 0.1 mL

SF3A2 (Splicing Factor 3A Subunit 2, PRP11, PRPF11, SF3a66, Spliceosome-associated Protein 62, SAP 62, SAP62) (MaxLight 490)

Sign In for Pricing
View Details
SF3A2 (Splicing Factor 3A Subunit 2, PRP11, PRPF11, SF3a66, Spliceosome-associated Protein 62, SAP 62, SAP62) (MaxLight 490)
MBS6203240-02 5x 0.1 mL

SF3A2 (Splicing Factor 3A Subunit 2, PRP11, PRPF11, SF3a66, Spliceosome-associated Protein 62, SAP 62, SAP62) (MaxLight 490)

Sign In for Pricing
View Details
C22orf23 (NM_032561) Human 3' UTR Clone
SC208472 10 µg

C22orf23 (NM_032561) Human 3' UTR Clone

Sign In for Pricing
View Details
Mest (NM_008590) Mouse Tagged ORF Clone
MG223261 10 µg

Mest (NM_008590) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ifit3 3'UTR Luciferase Stable Cell Line
TU206112 1.0 mL

Ifit3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details