Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM192 Rabbit Polyclonal Antibody (HRP)

TMEM192 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ38482

UniProt

Q8IY95

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFVVLAFLTGVLCSYPNPNEDKCPGNYTNPLKVQTVIILGKVILWILHLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001093859

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha 5 beta 1 Integrin Recombinant monoclonal antibody (M200) (Human IgG4 kappa)
MBS566879-01 0.2 mg

alpha 5 beta 1 Integrin Recombinant monoclonal antibody (M200) (Human IgG4 kappa)

Sign In for Pricing
View Details
alpha 5 beta 1 Integrin Recombinant monoclonal antibody (M200) (Human IgG4 kappa)
MBS566879-02 5x 0.2 mg

alpha 5 beta 1 Integrin Recombinant monoclonal antibody (M200) (Human IgG4 kappa)

Sign In for Pricing
View Details
Guinea Pig Long chain Fatty acyl CoA ELISA kit
GTR10419580 96 Well

Guinea Pig Long chain Fatty acyl CoA ELISA kit

Sign In for Pricing
View Details
ValRS Rabbit pAb
E47R12680 100 µL

ValRS Rabbit pAb

Sign In for Pricing
View Details
Cortactin (p80,85) (MaxLight 650) discontinued
C7901-80-ML650 100 µL

Cortactin (p80,85) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Exoc4 Rat shRNA Plasmid (Locus ID 116654)
TR712222 1 Kit

Exoc4 Rat shRNA Plasmid (Locus ID 116654)

Sign In for Pricing
View Details