Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL3 Rabbit Polyclonal Antibody (Biotin)

TTLL3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOTTL

UniProt

Q9Y4R7

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence GDMKLGKPLLRFPTALVLDPTPNKKKQVKYLGLDSIAVGGSRVDGARPCT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GDMKLGKPLLRFPTALVLDPTPNKKKQVKYLGLDSIAVGGSRVDGARPCT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

NCBI Accession Number

NP_001021100

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit
orb2812513-01 48 Tests

Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit

Sign In for Pricing
View Details
Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit
orb2812513-02 96 Tests

Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit

Sign In for Pricing
View Details
Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit
orb2812513-03 5 x 96 T

Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit

Sign In for Pricing
View Details
Human Epithelial Discoidin Domain-Containing Receptor 1 (DDR1) Protein
abx658111-01 10 µg

Human Epithelial Discoidin Domain-Containing Receptor 1 (DDR1) Protein

Sign In for Pricing
View Details
Human Epithelial Discoidin Domain-Containing Receptor 1 (DDR1) Protein
abx658111-02 50 µg

Human Epithelial Discoidin Domain-Containing Receptor 1 (DDR1) Protein

Sign In for Pricing
View Details
Human Epithelial Discoidin Domain-Containing Receptor 1 (DDR1) Protein
abx658111-03 100 µg

Human Epithelial Discoidin Domain-Containing Receptor 1 (DDR1) Protein

Sign In for Pricing
View Details